PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo16G0008400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family Dof
Protein Properties Length: 224aa    MW: 24550.5 Da    PI: 9.9593
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo16G0008400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.71.4e-392585262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     ke+ l+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk++s
  Spipo16G0008400 25 KEQPLSCPRCQSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRHS 85
                     67899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-282283IPR003851Zinc finger, Dof-type
PfamPF027016.2E-342783IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1342983IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103167IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MNPSMEDMAS STRPQLTERR PRPHKEQPLS CPRCQSTNTK FCYYNNYSLS QPRYFCKTCR  60
RYWTEGGSLR NVPVGGGSRK NKRHSTAAPK NTATNPSSSS QSYASSSSRK VSADLLPPQP  120
TRSSSFRNPR FHEEKGPQPA FTPVELLPAQ GLNPFMPVVG ADYTAVFGLQ DFRSAPEVSY  180
PLDAVGGGGV YGSMQGETTL KLSNLLSIDP KQIKSANFNG EIF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009397850.14e-58PREDICTED: dof zinc finger protein DOF4.6 isoform X1
RefseqXP_009397851.13e-58PREDICTED: dof zinc finger protein DOF4.6 isoform X2
TrEMBLM0SSH84e-58M0SSH8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P27160_0011e-57(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.14e-38Dof family protein